Antibodies
Rabbit polyclonal antibody to IGF1R ((insulin-like growth factor 1 receptor) | |
---|---|
![]() |
![]() |
Formulation | Lyophilized powder |
Purification | Affinity purified |
Host Species | Rabbit |
Unit Size: | 50 µg |
Immunogen | Synthetic peptide |
Sequence: | DRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC |
Alternative Names | CD221 |
Accession Number: | P08069 |
Gene Symbol | IGF1R |
Accession URL: | http://www.uniprot.org/uniprot/P08069 |
Function: IGF1R binds insulin-like growth factor 1 (IGF1) insulin-like growth factor 1 (IGF2).IGF1R is a tetramer composed of 2 alpha and 2 beta chains linked by disulfide bonds. The alpha chains is involved with the formation of the ligand-binding domain, and the beta chain carries the kinase domain.At a protein level is expressed in many tissues including muscle, heart, kidney, adipose tissue, skeletal muscle, fibroblasts, spleen and placenta. IGF1R is overexpressed in malignant tissues where it plays an anti-apoptotic function. |
|
Applications: | Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB). |
Working Dilution for Immunofluorescence (ICC): | 5 – 15 µg/mL |
Working Dilution for Immunohistochemistry (IHC): | 5 – 10 µg/mL |
Working Dilution for Western Blottin (WB): | 1 µg/mL |
IHC Positive control: | Kidney (epithelial cells in convoluted tubules); pancreas (islet cells). |
Specificity: | Confirmed by WB. |
Reactivity: | mouse |
Reconstitution: | Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material. |
Storage / Stability: | At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles. |
References
|